PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_D89BDD619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 59aa    MW: 6924.86 Da    PI: 10.2259
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_D89BDD619.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.6e-141558649
                           HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49
                           ++ r+ +NR++A+  R+RKka++ eLe kvk Le+ N++L ++l
  Traes_7AL_D89BDD619.1 15 NQSRLLRNRVSAQQARERKKAYMGELEAKVKDLETRNSELEERL 58
                           689*************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5021710.1621259IPR004827Basic-leucine zipper domain
PfamPF001702.2E-111558IPR004827Basic-leucine zipper domain
CDDcd147044.17E-111659No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-141658No hitNo description
SuperFamilySSF579591.83E-111658No hitNo description
PROSITE patternPS0003601832IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
LLFTLNNYVV SLQSNQSRLL RNRVSAQQAR ERKKAYMGEL EAKVKDLETR NSELEERLS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3633003e-54AK363300.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2014C16.
GenBankAK3756943e-54AK375694.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3101I12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525968.11e-17PREDICTED: transcription factor HY5-like
RefseqXP_013620110.11e-17PREDICTED: transcription factor HY5-like
RefseqXP_013678598.11e-17PREDICTED: transcription factor HY5-like
SwissprotO246462e-17HY5_ARATH; Transcription factor HY5
TrEMBLW5HB864e-34W5HB86_WHEAT; Uncharacterized protein
STRINGBra008976.1-P6e-17(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-18bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]